Loading...
Statistics
Advertisement

Dog-support.nl

Advertisement
Dog-support.nl is hosted in Netherlands . Dog-support.nl uses HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache/2.

Technologies in use by Dog-support.nl

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache/2

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Dog-support.nl

SSL certificate

    • name: /C=US/ST=Someprovince/L=Sometown/O=none/OU=none/CN=localhost/emailAddress=webmaster@localhost
    • subject:
      • C: US
      • ST: Someprovince
      • L: Sometown
      • O: none
      • OU: none
      • CN: localhost
      • emailAddress: webmaster@localhost
    • hash: c4d44870
    • issuer:
      • C: US
      • ST: Someprovince
      • L: Sometown
      • O: none
      • OU: none
      • CN: localhost
      • emailAddress: webmaster@localhost
    • version: 0
    • serialNumber: 12174986227228270652
    • validFrom: 130326131307Z
    • validTo: 400810131307Z
    • validFrom_time_t: 1364303587
    • validTo_time_t: 2228217187
    • extensions:

    Meta - Dog-support.nl

    Number of occurences: 1
    • Name:
      Content: 0;url= dogsupport/DogSupport.html

    Server / Hosting

    • IP: 85.17.149.11
    • Latitude: 52.38
    • Longitude: 4.90
    • Country: Netherlands

    Rname

    • ns2.domeinstad.nl
    • ns1.domeinstad.nl
    • mail.dog-support.nl

    Target

    • tech.domeinstad.nl

    HTTP Header Response

    HTTP/1.1 200 OK Date: Thu, 30 Jun 2016 18:26:18 GMT Server: Apache/2 Last-Modified: Fri, 04 Sep 2015 12:41:22 GMT ETag: "8e19e7-143-51eeb3792cc62" Accept-Ranges: bytes Content-Length: 323 Vary: Accept-Encoding,User-Agent Content-Type: text/html X-Cache: MISS from s_xt27 X-Cache-Lookup: MISS from s_xt27:80 Via: 1.1 s_xt27 (squid/3.5.6) Connection: keep-alive

    DNS

    host: dog-support.nl
    1. class: IN
    2. ttl: 120
    3. type: A
    4. ip: 85.17.149.11
    host: dog-support.nl
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns2.domeinstad.nl
    host: dog-support.nl
    1. class: IN
    2. ttl: 86400
    3. type: NS
    4. target: ns1.domeinstad.nl
    host: dog-support.nl
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns1.domeinstad.nl
    5. rname: tech.domeinstad.nl
    6. serial: 2015102117
    7. refresh: 10800
    8. retry: 3600
    9. expire: 604800
    10. minimum-ttl: 3600
    host: dog-support.nl
    1. class: IN
    2. ttl: 120
    3. type: MX
    4. pri: 25
    5. target: mail.dog-support.nl
    host: dog-support.nl
    1. class: IN
    2. ttl: 86400
    3. type: TXT
    4. txt: v=spf1 ip4:94.75.202.0/24 a mx ~all
    5. entries: Array

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.og-support.nl, www.dtog-support.nl, www.tog-support.nl, www.dgog-support.nl, www.gog-support.nl, www.dbog-support.nl, www.bog-support.nl, www.dxog-support.nl, www.xog-support.nl, www.dsog-support.nl, www.sog-support.nl, www.dfog-support.nl, www.fog-support.nl, www.dvog-support.nl, www.vog-support.nl, www.dyog-support.nl, www.yog-support.nl, www.dzog-support.nl, www.zog-support.nl, www.daog-support.nl, www.aog-support.nl, www.deog-support.nl, www.eog-support.nl, www.drog-support.nl, www.rog-support.nl, www.dg-support.nl, www.dobg-support.nl, www.dbg-support.nl, www.dohg-support.nl, www.dhg-support.nl, www.dogg-support.nl, www.dgg-support.nl, www.dojg-support.nl, www.djg-support.nl, www.domg-support.nl, www.dmg-support.nl, www.do g-support.nl, www.d g-support.nl, www.dovg-support.nl, www.dvg-support.nl, www.do-support.nl, www.dogs-support.nl, www.dos-support.nl, www.dogx-support.nl, www.dox-support.nl, www.dogy-support.nl, www.doy-support.nl, www.dogh-support.nl, www.doh-support.nl, www.dogn-support.nl, www.don-support.nl, www.dogc-support.nl, www.doc-support.nl, www.dogd-support.nl, www.dod-support.nl, www.doge-support.nl, www.doe-support.nl, www.dogr-support.nl, www.dor-support.nl, www.dogt-support.nl, www.dot-support.nl, www.dogb-support.nl, www.dob-support.nl, www.dogv-support.nl, www.dov-support.nl, www.dogsupport.nl, www.dog-tsupport.nl, www.dogtsupport.nl, www.dog-gsupport.nl, www.doggsupport.nl, www.dog-hsupport.nl, www.doghsupport.nl, www.dog-usupport.nl, www.dogusupport.nl, www.dog-jsupport.nl, www.dogjsupport.nl, www.dog-xsupport.nl, www.dogxsupport.nl, www.dog-ssupport.nl, www.dogssupport.nl, www.dog-asupport.nl, www.dogasupport.nl, www.dog-support.nl, www.dogsupport.nl, www.dog- support.nl, www.dog support.nl, www.dog-upport.nl, www.dog-seupport.nl, www.dog-eupport.nl, www.dog-swupport.nl, www.dog-wupport.nl, www.dog-sdupport.nl, www.dog-dupport.nl, www.dog-sxupport.nl, www.dog-xupport.nl, www.dog-sfupport.nl, www.dog-fupport.nl, www.dog-sgupport.nl, www.dog-gupport.nl, www.dog-stupport.nl, www.dog-tupport.nl, www.dog-spport.nl, www.dog-suwpport.nl, www.dog-swpport.nl, www.dog-suepport.nl, www.dog-sepport.nl, www.dog-suspport.nl, www.dog-sspport.nl, www.dog-suapport.nl, www.dog-sapport.nl, www.dog-suport.nl, www.dog-supiport.nl, www.dog-suiport.nl, www.dog-supkport.nl, www.dog-sukport.nl, www.dog-supuport.nl, www.dog-suuport.nl, www.dog-supjport.nl, www.dog-sujport.nl, www.dog-suplport.nl, www.dog-sulport.nl, www.dog-suport.nl, www.dog-suppiort.nl, www.dog-supiort.nl, www.dog-suppkort.nl, www.dog-supkort.nl, www.dog-suppuort.nl, www.dog-supuort.nl, www.dog-suppjort.nl, www.dog-supjort.nl, www.dog-supplort.nl, www.dog-suplort.nl, www.dog-supprt.nl, www.dog-suppobrt.nl, www.dog-suppbrt.nl, www.dog-suppohrt.nl, www.dog-supphrt.nl, www.dog-suppogrt.nl, www.dog-suppgrt.nl, www.dog-suppojrt.nl, www.dog-suppjrt.nl, www.dog-suppomrt.nl, www.dog-suppmrt.nl, www.dog-suppo rt.nl, www.dog-supp rt.nl, www.dog-suppovrt.nl, www.dog-suppvrt.nl, www.dog-suppot.nl, www.dog-supporit.nl, www.dog-suppoit.nl, www.dog-supporot.nl, www.dog-suppoot.nl, www.dog-supporlt.nl, www.dog-suppolt.nl, www.dog-supporlt.nl, www.dog-suppolt.nl, www.dog-suppor.t.nl, www.dog-suppo.t.nl, www.dog-suppor.nl, www.dog-supportq.nl, www.dog-supporq.nl, www.dog-supporta.nl, www.dog-suppora.nl, www.dog-support .nl, www.dog-suppor .nl, www.dog-supportw.nl, www.dog-supporw.nl, www.dog-supporte.nl, www.dog-suppore.nl, www.dog-supportz.nl, www.dog-supporz.nl, www.dog-supportx.nl, www.dog-supporx.nl, www.dog-supportc.nl, www.dog-supporc.nl,

    Other websites we recently analyzed

    1. ms | rePortal - Ankaufsportal vom Entsorgungsspezialisten - Metall- Edelmetall-Entsorgung | Weißenhorn | Neu-Ulm
      Wir begleiten Sie in allen Belangen Ihrer betrieblichen Entsorgungs-Kreisläufe und übernehmen gleichzeitig sämtliche Dienstleistungen.
      Germany - 217.7.88.50
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery, Google Analytics
      Number of Javascript: 9
      Number of meta tags: 6
    2. instantcontacts.com - Diese Website steht zum Verkauf! - Informationen zum Thema instant contacts.
      Diese
      Cambridge (United States) - 72.52.4.90
      Server software: Apache
      Technology: Google Adsense, Html, Html5, Javascript, Php, SVG
      Number of Javascript: 3
      Number of meta tags: 5
    3. Vacation Homes in South West
      Find and book your perfect vacation rental Vacation Homes in South West.
      Chesterfield (United States) - 64.14.68.91
      Server software: Apache
      Technology: CSS, Html
      Number of meta tags: 3
    4. Home - Charles Galloway Photography
      United Kingdom - 79.170.40.54
      Server software: Apache/2.4.18 (Unix)
      Technology: CSS, Html, Html5, Javascript, Php
      Number of Javascript: 10
      Number of meta tags: 4
    5. CottonCandy Design Studio.
      Check out this GoDaddy hosted webpage! http://cottoncandydesign.com.
      Scottsdale (United States) - 97.74.42.79
      Server software: Microsoft-IIS/7.0
      Technology: CSS, Html, Javascript, jQuery, jQuery UI
      Number of Javascript: 4
      Number of meta tags: 3
    6. gckrt.win
      Austin (United States) - 209.99.40.227
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    7. dcixtl.cn
      Walnut (United States) - 104.217.72.157
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Php, SVG
      Number of Javascript: 2
      Number of meta tags: 3
    8. enobo.us – Elke and Oliver's Blog
      Chicago (United States) - 181.224.138.25
      Server software: nginx
      Technology: CSS, Google Font API, Gravatar, Html, Html5, Javascript, jQuery, Php, Pingback, WordPress Stats, Wordpress
      Number of Javascript: 10
      Number of meta tags: 4
    9. virgingalacticspaceflightsystems.biz
      United States - 208.91.197.27
      Server software: Apache
      Technology: Html
      Number of meta tags: 2
    10. ICE COLD LOVE.COM | The Legendary – ICE COLD LOVE Website
      Houston (United States) - 192.185.13.242
      Server software: nginx/1.10.1
      Technology: CSS, Html, Html5, Javascript, jQuery, MediaElement, Php, Pingback, Wordpress
      Number of Javascript: 6
      Number of meta tags: 3

    Check Other Websites